Lineage for d3hina_ (3hin A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.14: ClpP/crotonase [52095] (1 superfamily)
core: 4 turns of (beta-beta-alpha)n superhelixSuperfamily c.14.1: ClpP/crotonase [52096] (5 families) 
Family c.14.1.0: automated matches [191346] (1 protein)
not a true familyProtein automated matches [190246] (71 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:1076] [196563] (1 PDB entry) 
Domain d3hina_: 3hin A: [196565]
automated match to d3q0jd_
Details for d3hina_
PDB Entry: 3hin (more details), 2 Å
PDB Description: crystal structure of putative enoyl-coa hydratase from rhodopseudomonas palustris cga009
PDB Compounds: (A:) Putative 3-hydroxybutyryl-CoA dehydrataseSCOPe Domain Sequences for d3hina_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hina_ c.14.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
aatiadpstlvvdtvgpvltiglnrpkkrnalndglmaalkdcltdipdqiravvihgig
dhfsagldlselrerdateglvhsqtwhrvfdkiqycrvpviaalkgaviggglelacaa
hirvaeasayyalpegsrgifvggggsvrlprligvarmadmmltgrvysaaegvvhgfs
qyliengsaydkalelgnrvaqnapltnfavlqalpmiaeanpqtgllmeslmatvaqsd
qeaktrirafldhktakv
SCOPe Domain Coordinates for d3hina_:
Click to download the PDB-style file with coordinates for d3hina_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hina_:
- d3hina_ first appeared in SCOPe 2.02
- d3hina_ appears in SCOPe 2.07
View in 3D
