| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
| Protein automated matches [191036] (17 species) not a true protein |
| Species Bartonella henselae [TaxId:283166] [225687] (1 PDB entry) |
| Domain d3hhja_: 3hhj A: [211030] automated match to d3r03a_ complexed with mg |
PDB Entry: 3hhj (more details), 2.1 Å
SCOPe Domain Sequences for d3hhja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhja_ d.113.1.0 (A:) automated matches {Bartonella henselae [TaxId: 283166]}
sllivvacalldqdnrvlltqrpegkslaglwefpggkveqgetpeaslireleeelgvh
vqadnlfpltfashgyetfhllmplyfcshykgvaqgregqnlkwifindldkypmpead
kplvqvlknf
Timeline for d3hhja_: