Lineage for d3hhha_ (3hhh A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.0: automated matches [191329] (1 protein)
not a true familyProtein automated matches [190154] (68 species)
not a true protein
Species Enterococcus faecalis [TaxId:1351] [188913] (1 PDB entry) 
Domain d3hhha_: 3hhh A: [177574]
automated match to d1xmab_
complexed with gol, so4
Details for d3hhha_
PDB Entry: 3hhh (more details), 2.7 Å
PDB Description: Crystal structure of transcriptional regulator, a member of PadR family, from Enterococcus faecalis V583
PDB Compounds: (A:) Transcriptional regulator, PadR familySCOPe Domain Sequences for d3hhha_:
Sequence, based on SEQRES records: (download)
>d3hhha_ a.4.5.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
ekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkkn
Sequence, based on observed residues (ATOM records): (download)
>d3hhha_ a.4.5.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
ekkpsepmrkfyrltssgeaeladfwqrwtllskqvnkmkkn
SCOPe Domain Coordinates for d3hhha_:
Click to download the PDB-style file with coordinates for d3hhha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hhha_:
- d3hhha_ first appeared in SCOPe 2.01
- d3hhha_ appears in SCOPe 2.05
- d3hhha_ appears in SCOPe 2.07
- d3hhha_ appears in the current release, SCOPe 2.08
View in 3D
