Lineage for d3hh2a_ (3hh2 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3034003Species Mouse (Mus musculus) [TaxId:10090] [188989] (3 PDB entries)
  8. 3034005Domain d3hh2a_: 3hh2 A: [177565]
    automated match to d1s4yb_
    complexed with cit, po4

Details for d3hh2a_

PDB Entry: 3hh2 (more details), 2.15 Å

PDB Description: crystal structure of the myostatin:follistatin 288 complex
PDB Compounds: (A:) Growth/differentiation factor 8

SCOPe Domain Sequences for d3hh2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hh2a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

SCOPe Domain Coordinates for d3hh2a_:

Click to download the PDB-style file with coordinates for d3hh2a_.
(The format of our PDB-style files is described here.)

Timeline for d3hh2a_: