Lineage for d3hgia_ (3hgi A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2380104Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2380105Protein automated matches [227026] (6 species)
    not a true protein
  7. 2380119Species Rhodococcus opacus [TaxId:37919] [225810] (11 PDB entries)
  8. 2380132Domain d3hgia_: 3hgi A: [211029]
    automated match to d1s9aa_
    complexed with 6pl, bez, co3, fe

Details for d3hgia_

PDB Entry: 3hgi (more details), 1.94 Å

PDB Description: Crystal structure of Catechol 1,2-Dioxygenase from the gram-positive Rhodococcus opacus 1CP
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d3hgia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hgia_ b.3.6.0 (A:) automated matches {Rhodococcus opacus [TaxId: 37919]}
eratadtsperlaaiakdalgalndvilkhgvtypeyrvfkqwlidvgeggewplfldvf
iehsveevlarsrkgtmgsiegpyyienspelpskctlpmreedekitplvfsgqvtdld
gnglagakvelwhadndgyysqfaphlpewnlrgtiiadeegryeittiqpapyqiptdg
ptgqfieaqnghpwrpahlhlivsapgkesvttqlyfkggewidsdvasatkpelildpk
tgddgknyvtynfvldpa

SCOPe Domain Coordinates for d3hgia_:

Click to download the PDB-style file with coordinates for d3hgia_.
(The format of our PDB-style files is described here.)

Timeline for d3hgia_: