Class b: All beta proteins [48724] (178 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) |
Family b.3.6.0: automated matches [227249] (1 protein) not a true family |
Protein automated matches [227026] (6 species) not a true protein |
Species Rhodococcus opacus [TaxId:37919] [225810] (11 PDB entries) |
Domain d3hgia_: 3hgi A: [211029] automated match to d1s9aa_ complexed with 6pl, bez, co3, fe |
PDB Entry: 3hgi (more details), 1.94 Å
SCOPe Domain Sequences for d3hgia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hgia_ b.3.6.0 (A:) automated matches {Rhodococcus opacus [TaxId: 37919]} eratadtsperlaaiakdalgalndvilkhgvtypeyrvfkqwlidvgeggewplfldvf iehsveevlarsrkgtmgsiegpyyienspelpskctlpmreedekitplvfsgqvtdld gnglagakvelwhadndgyysqfaphlpewnlrgtiiadeegryeittiqpapyqiptdg ptgqfieaqnghpwrpahlhlivsapgkesvttqlyfkggewidsdvasatkpelildpk tgddgknyvtynfvldpa
Timeline for d3hgia_: