Lineage for d3hdoa_ (3hdo A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.0: automated matches [191328] (1 protein)
not a true familyProtein automated matches [190151] (98 species)
not a true protein
Species Geobacter metallireducens [TaxId:269799] [225685] (1 PDB entry) 
Domain d3hdoa_: 3hdo A: [211002]
automated match to d3getb_
complexed with gol, mg
Details for d3hdoa_
PDB Entry: 3hdo (more details), 1.61 Å
PDB Description: crystal structure of a histidinol-phosphate aminotransferase from geobacter metallireducens
PDB Compounds: (A:) Histidinol-phosphate aminotransferaseSCOPe Domain Sequences for d3hdoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdoa_ c.67.1.0 (A:) automated matches {Geobacter metallireducens [TaxId: 269799]}
iplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalriyp
sassqklrevagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyygtla
evqgarvrtfgltgdfriagfperyegkvfflttpnaplgpsfpleyidelarrcagmlv
ldetyaefaesnalelvrrhenvvvtrtlsksyslagmriglaiarpeviaaldkirdhy
nldrlaqaacvaalrdqaylseccrriretrewfttelrsigydvipsqgnylfatppdr
dgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaalkeige
SCOPe Domain Coordinates for d3hdoa_:
Click to download the PDB-style file with coordinates for d3hdoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hdoa_:
- d3hdoa_ first appeared in SCOPe 2.03
- d3hdoa_ appears in SCOPe 2.04
- d3hdoa_ is called d3hdoa1 in SCOPe 2.06
- d3hdoa_ appears in the current release, SCOPe 2.08, called d3hdoa1
View in 3D
