Lineage for d3hd3b_ (3hd3 B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (24 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.1: Papain-like [54002] (26 proteins) Protein Cruzain [54020] (1 species) Species Trypanosoma cruzi [TaxId:5693] [54021] (25 PDB entries) 
Domain d3hd3b_: 3hd3 B: [177401]
automated match to d1ewla_
complexed with 25b, edo, eoh, peg, so4
Details for d3hd3b_
PDB Entry: 3hd3 (more details), 1.75 Å
PDB Description: high resolution crystal structure of cruzain bound to the vinyl sulfone inhibitor smdc-256047
PDB Compounds: (B:) CruzipainSCOPe Domain Sequences for d3hd3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hd3b_ d.3.1.1 (B:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlaeqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndgaavpywii
knswttqwgeegyiriakgsnqclvkeeassavv
SCOPe Domain Coordinates for d3hd3b_:
Click to download the PDB-style file with coordinates for d3hd3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3hd3b_:
- d3hd3b_ first appeared in SCOPe 2.01
- d3hd3b_ appears in SCOPe 2.05
- d3hd3b_ appears in SCOPe 2.07
- d3hd3b_ appears in the current release, SCOPe 2.08
View in 3D
