Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Cytophaga hutchinsonii [TaxId:269798] [232457] (1 PDB entry) |
Domain d3hcza_: 3hcz A: [232458] automated match to d4nmua_ complexed with fmt, so4 |
PDB Entry: 3hcz (more details), 1.88 Å
SCOPe Domain Sequences for d3hcza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hcza_ c.47.1.0 (A:) automated matches {Cytophaga hutchinsonii [TaxId: 269798]} naplllgkkapnlymtdttgtyrylydvqakytilffwdsqcghcqqetpklydwwlknr akgiqvyaanierkdeewlkfirskkiggwlnvrdsknhtdfkitydiyatpvlyvldkn kviiakrigyenlddflvqyekslktk
Timeline for d3hcza_: