| Class b: All beta proteins [48724] (176 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
| Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
| Protein automated matches [190637] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187699] (6 PDB entries) |
| Domain d3hbwa_: 3hbw A: [246489] automated match to d1q1ua_ |
PDB Entry: 3hbw (more details), 1.9 Å
SCOPe Domain Sequences for d3hbwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hbwa_ b.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvvaiqgvqtklyl
amnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylglnkegeimkgn
hvkknkpaahflpkplkvamykepslhdl
Timeline for d3hbwa_: