Lineage for d3h7ia2 (3h7i A:181-305)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) 
Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) Protein T4 RNase H [47809] (1 species) Species Bacteriophage T4 [TaxId:10665] [47810] (6 PDB entries) 
Domain d3h7ia2: 3h7i A:181-305 [232417]
Other proteins in same PDB: d3h7ia1
automated match to d1tfra1
complexed with so4
Details for d3h7ia2
PDB Entry: 3h7i (more details), 1.5 Å
PDB Description: structure of the metal-free d132n t4 rnase h
PDB Compounds: (A:) Ribonuclease HSCOPe Domain Sequences for d3h7ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h7ia2 a.60.7.1 (A:181-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
ksgsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqak
vllteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltn
sinef
SCOPe Domain Coordinates for d3h7ia2:
Click to download the PDB-style file with coordinates for d3h7ia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h7ia2:
- d3h7ia2 first appeared in SCOPe 2.03
- d3h7ia2 appears in SCOPe 2.05
- d3h7ia2 appears in SCOPe 2.07
- d3h7ia2 appears in the current release, SCOPe 2.08
View in 3D
