Lineage for d3h7ia1 (3h7i A:4-180)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.120: PIN domain-like [88722] (1 superfamily)
3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145Superfamily c.120.1: PIN domain-like [88723] (3 families) 
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like foldProtein T4 RNase H [53046] (1 species) Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries) 
Domain d3h7ia1: 3h7i A:4-180 [232416]
Other proteins in same PDB: d3h7ia2
automated match to d1tfra2
complexed with so4
Details for d3h7ia1
PDB Entry: 3h7i (more details), 1.5 Å
PDB Description: structure of the metal-free d132n t4 rnase h
PDB Compounds: (A:) Ribonuclease HSCOPe Domain Sequences for d3h7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h7ia1 c.120.1.2 (A:4-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
emmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgy
tkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyiv
mdidkyeandhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
SCOPe Domain Coordinates for d3h7ia1:
Click to download the PDB-style file with coordinates for d3h7ia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h7ia1:
- d3h7ia1 first appeared in SCOPe 2.03
- d3h7ia1 appears in SCOPe 2.06
- d3h7ia1 appears in the current release, SCOPe 2.08
View in 3D
