Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) |
Family d.41.3.0: automated matches [254277] (1 protein) not a true family |
Protein automated matches [254643] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [255860] (1 PDB entry) |
Domain d3h5qa3: 3h5q A:331-433 [246471] Other proteins in same PDB: d3h5qa1, d3h5qa2, d3h5qa4 automated match to d1brwa3 complexed with so4, thm |
PDB Entry: 3h5q (more details), 1.94 Å
SCOPe Domain Sequences for d3h5qa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h5qa3 d.41.3.0 (A:331-433) automated matches {Staphylococcus aureus [TaxId: 93062]} qaqyqieykakksgyvtelvsndigvasmmlgagrltkeddidlavgivlnkkigdkvee geslltihsnrqdvddvvkkldssitiadhvvsptlihkiite
Timeline for d3h5qa3: