Lineage for d3h4ma_ (3h4m A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479358Protein Proteasome-activating nucleotidase PAN, C-terminal domain [346084] (1 species)
  7. 2479359Species Methanocaldococcus jannaschii [TaxId:2190] [346303] (1 PDB entry)
  8. 2479360Domain d3h4ma_: 3h4m A: [246464]
    automated match to d1iy2a_
    complexed with adp

Details for d3h4ma_

PDB Entry: 3h4m (more details), 3.11 Å

PDB Description: AAA ATPase domain of the proteasome- activating nucleotidase
PDB Compounds: (A:) Proteasome-activating nucleotidase

SCOPe Domain Sequences for d3h4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h4ma_ c.37.1.20 (A:) Proteasome-activating nucleotidase PAN, C-terminal domain {Methanocaldococcus jannaschii [TaxId: 2190]}
amevderpnvryedigglekqmqeirevvelplkhpelfekvgieppkgillygppgtgk
tllakavatetnatfirvvgselvkkfigegaslvkdifklakekapsiifideidaiaa
krtdaltggdrevqrtlmqllaemdgfdargdvkiigatnrpdildpailrpgrfdriie
vpapdekgrleilkihtrkmnlaedvnleeiakmtegcvgaelkaicteagmnairelrd
yvtmddfrkavekimekkkvk

SCOPe Domain Coordinates for d3h4ma_:

Click to download the PDB-style file with coordinates for d3h4ma_.
(The format of our PDB-style files is described here.)

Timeline for d3h4ma_: