Lineage for d3h47a1 (3h47 A:1-147)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739496Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1739497Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1739498Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1739629Protein automated matches [190369] (6 species)
    not a true protein
  7. 1739645Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232370] (2 PDB entries)
  8. 1739646Domain d3h47a1: 3h47 A:1-147 [232371]
    Other proteins in same PDB: d3h47a2
    automated match to d1e6jp2

Details for d3h47a1

PDB Entry: 3h47 (more details), 1.9 Å

PDB Description: x-ray structure of hexameric hiv-1 ca
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3h47a1:

Sequence, based on SEQRES records: (download)

>d3h47a1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d3h47a1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghq
aamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d3h47a1:

Click to download the PDB-style file with coordinates for d3h47a1.
(The format of our PDB-style files is described here.)

Timeline for d3h47a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h47a2