Lineage for d3h08b_ (3h08 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.0: automated matches [191357] (1 protein)
not a true familyProtein automated matches [190396] (40 species)
not a true protein
Species Chlorobaculum tepidum [TaxId:1097] [225664] (1 PDB entry) 
Domain d3h08b_: 3h08 B: [210753]
automated match to d2zqbb_
complexed with mg
Details for d3h08b_
PDB Entry: 3h08 (more details), 1.6 Å
PDB Description: crystal structure of the ribonuclease h1 from chlorobium tepidum
PDB Compounds: (B:) Rnh (Ribonuclease H)SCOPe Domain Sequences for d3h08b_:
Sequence, based on SEQRES records: (download)
>d3h08b_ c.55.3.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
ektitiytdgaasgnpgkggwgallmygssrkeisgydpattnnrmelmaaikglealke
parvqlysdsaylvnamnegwlkrwvkngwktaakkpvenidlwqeilklttlhrvtfhk
vkghsdnpynsradelarlaiken
Sequence, based on observed residues (ATOM records): (download)
>d3h08b_ c.55.3.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
ektitiytdgaasgnpgkggwgallmygssrkeisgydpattnnrmelmaaikglealke
parvqlysdsaylvnamnegwlkrwvkngwktakkpvenidlwqeilklttlhrvtfhkv
kgsdnpynsradelarlaiken
SCOPe Domain Coordinates for d3h08b_:
Click to download the PDB-style file with coordinates for d3h08b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h08b_:
- d3h08b_ first appeared in SCOPe 2.03
- d3h08b_ appears in SCOPe 2.07
View in 3D
