Lineage for d3gzxa2 (3gzx A:179-457)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926677Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1926678Protein automated matches [190218] (20 species)
    not a true protein
  7. 1926744Species Comamonas testosteroni [TaxId:285] [232354] (2 PDB entries)
  8. 1926746Domain d3gzxa2: 3gzx A:179-457 [232355]
    Other proteins in same PDB: d3gzxa1, d3gzxb_
    automated match to d1eg9a2
    complexed with bnl, fe2, fes, gol, mes

Details for d3gzxa2

PDB Entry: 3gzx (more details), 1.58 Å

PDB Description: crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. strain b-356
PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d3gzxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzxa2 d.129.3.0 (A:179-457) automated matches {Comamonas testosteroni [TaxId: 285]}
eapdlktylsdampymdvmldrteagteaiggiqkwvipcnwkfaaeqfcsdmyhagtms
hlsgvlaglppemdltqiqlskngnqfrsawgghgagwfindssillsvvgpkitqywtq
gpaaekaarrvpqlpildmfgqhmtvfptcsflpgintirtwhprgpnevevwafvlvda
dapedikeefrlqnirtfnaggvfeqddgenwveiqrvmrghkakstslcakmglnvpnk
nnpaypgktayvyaeeaargmyhhwsrmmsepswdtlkp

SCOPe Domain Coordinates for d3gzxa2:

Click to download the PDB-style file with coordinates for d3gzxa2.
(The format of our PDB-style files is described here.)

Timeline for d3gzxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gzxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3gzxb_