Lineage for d3gzma_ (3gzm A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-down
Superfamily a.28.1: ACP-like [47336] (4 families) 
Family a.28.1.0: automated matches [191582] (1 protein)
not a true familyProtein automated matches [191038] (20 species)
not a true protein
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188862] (2 PDB entries) 
Domain d3gzma_: 3gzm A: [177112]
automated match to d1acpa_
complexed with bme, mli, pns
Details for d3gzma_
PDB Entry: 3gzm (more details), 1.8 Å
PDB Description: Crystal Structure of holo PfACP Reduced Monomer
PDB Compounds: (A:) Acyl carrier proteinSCOPe Domain Sequences for d3gzma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzma_ a.28.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
slkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdqd
alkintvqdaidyieknn
SCOPe Domain Coordinates for d3gzma_:
Click to download the PDB-style file with coordinates for d3gzma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gzma_:
- d3gzma_ first appeared in SCOPe 2.01
- d3gzma_ appears in SCOPe 2.05
- d3gzma_ appears in SCOPe 2.07
- d3gzma_ appears in the current release, SCOPe 2.08
View in 3D
