Lineage for d3gxub_ (3gxu B:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding site
Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
automatically mapped to Pfam PF00812
Protein Ephrin-b2 ectodomain [74875] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [190026] (2 PDB entries) 
Domain d3gxub_: 3gxu B: [177080]
Other proteins in same PDB: d3gxua_
automated match to d1ikop_
Details for d3gxub_
PDB Entry: 3gxu (more details), 2.5 Å
PDB Description: Crystal structure of Eph receptor and ephrin complex
PDB Compounds: (B:) ephrin-b2SCOPe Domain Sequences for d3gxub_:
Sequence, based on SEQRES records: (download)
>d3gxub_ b.6.1.5 (B:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]}
sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld
nqeggvcqtramkilmkvgqdas
Sequence, based on observed residues (ATOM records): (download)
>d3gxub_ b.6.1.5 (B:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]}
sivlepiywnssnskflpgqglvlypqigdkldiicpkvtvqyeyykvymvdkdqadrct
ikentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqegg
vcqtramkilmkvgqdas
SCOPe Domain Coordinates for d3gxub_:
Click to download the PDB-style file with coordinates for d3gxub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gxub_:
- d3gxub_ first appeared in SCOPe 2.01
- d3gxub_ appears in SCOPe 2.03
- d3gxub_ appears in SCOPe 2.05
- d3gxub_ appears in the current release, SCOPe 2.08
View in 3D
