![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) ![]() |
![]() | Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins) automatically mapped to Pfam PF01404 |
![]() | Protein automated matches [190969] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries) |
![]() | Domain d3gxua_: 3gxu A: [177079] Other proteins in same PDB: d3gxub_ automated match to d1kgya_ |
PDB Entry: 3gxu (more details), 2.5 Å
SCOPe Domain Sequences for d3gxua_:
Sequence, based on SEQRES records: (download)
>d3gxua_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw itregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidti aadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk
>d3gxua_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw itregaqrvyieikftlrdcnslpgtcketfnlyyyesdndkerfienqfvkidtiaade sftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk
Timeline for d3gxua_: