Lineage for d3gwga_ (3gwg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855984Species Helicobacter pylori [TaxId:85962] [189260] (3 PDB entries)
  8. 2855985Domain d3gwga_: 3gwg A: [177059]
    automated match to d2chea_
    complexed with mg, so4

Details for d3gwga_

PDB Entry: 3gwg (more details), 1.8 Å

PDB Description: Crystal structure of CheY of Helicobacter pylori
PDB Compounds: (A:) Chemotaxis protein cheY homolog

SCOPe Domain Sequences for d3gwga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gwga_ c.23.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitdwnmpemn
gldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkeklevvl
gtn

SCOPe Domain Coordinates for d3gwga_:

Click to download the PDB-style file with coordinates for d3gwga_.
(The format of our PDB-style files is described here.)

Timeline for d3gwga_: