Lineage for d3gwea1 (3gwe A:4-184)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165305Species Burkholderia pseudomallei [TaxId:320372] [232341] (2 PDB entries)
  8. 2165310Domain d3gwea1: 3gwe A:4-184 [246372]

Details for d3gwea1

PDB Entry: 3gwe (more details), 2.1 Å

PDB Description: 2.1 Angstrom crystal structure of 3-oxoacyl-(acyl-carrier-protein) synthase III
PDB Compounds: (A:) 3-oxoacyl-(Acyl-carrier-protein) synthase III

SCOPe Domain Sequences for d3gwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gwea1 c.95.1.0 (A:4-184) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aahppraaiadiaghlpeqvltndvlaqlypdwpaekilaktgirerriaapretaadla
yeaarklfaqgavgadqvdfvilctqapdyvlptsacmlqhrlgipthagaldvnlgcsg
yvyglslakglvetgaarcvllltadtyskylhpldksvrtlfgdgasataviaehgele
r

SCOPe Domain Coordinates for d3gwea1:

Click to download the PDB-style file with coordinates for d3gwea1.
(The format of our PDB-style files is described here.)

Timeline for d3gwea1:

2165310
d3gwea1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3gwea2