![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
![]() | Protein Glutathione reductase [55426] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries) |
![]() | Domain d3grsa3: 3grs A:364-478 [40152] Other proteins in same PDB: d3grsa1, d3grsa2 complexed with fad, po4 |
PDB Entry: 3grs (more details), 1.54 Å
SCOPe Domain Sequences for d3grsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Timeline for d3grsa3: