Lineage for d3gr3b_ (3gr3 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) 
Family d.90.1.0: automated matches [191446] (1 protein)
not a true familyProtein automated matches [190672] (32 species)
not a true protein
Species Bartonella henselae [TaxId:283166] [267839] (1 PDB entry) 
Domain d3gr3b_: 3gr3 B: [264812]
automated match to d3gbhc_
complexed with act, cl, edo, fmn, unl
Details for d3gr3b_
PDB Entry: 3gr3 (more details), 1.45 Å
PDB Description: crystal structure of a nitroreductase-like family protein (pnba, bh06130) from bartonella henselae str. houston-1 at 1.45 a resolution
PDB Compounds: (B:) NitroreductaseSCOPe Domain Sequences for d3gr3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gr3b_ d.90.1.0 (B:) automated matches {Bartonella henselae [TaxId: 283166]}
apidifqsilsrksiraftdqpvtqetireilklaarapsgtnlqpwqvivltgkilqkv
gqelsqlvlsgikgereyhyyprqwrepylsrrrkvgldlykslgiqkgdqekmlhqkak
nflfygapvgllftidhdmemgswldlgmfmqtimlaargfgldtcaqaafadyhkqirs
llsvpsdrhiicgmalgyrdmnapennfeterepidnfvhfiksyp
SCOPe Domain Coordinates for d3gr3b_:
Click to download the PDB-style file with coordinates for d3gr3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gr3b_:
- d3gr3b_ first appeared in SCOPe 2.05
- d3gr3b_ appears in SCOPe 2.07
View in 3D
