Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein V1 ATP synthase B subunit, central domain [310705] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [310933] (2 PDB entries) |
Domain d3gqbb2: 3gqb B:79-361 [305431] Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba3, d3gqba4, d3gqbb1, d3gqbb3, d3gqbc1, d3gqbc2, d3gqbc3, d3gqbc4, d3gqbd1, d3gqbd3 |
PDB Entry: 3gqb (more details), 2.8 Å
SCOPe Domain Sequences for d3gqbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gqbb2 c.37.1.11 (B:79-361) V1 ATP synthase B subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]} varlgvskemlgrrfngigkpidglppitpekrlpitglplnpvarrkpeqfiqtgisti dvmntlvrgqklpifsgsglpaneiaaqiarqatvrpdlsgegekeepfavvfaamgitq relsyfiqefertgalsrsvlflnkaddptieriltprmaltvaeylafehdyhvlvilt dmtnysealreigaareeipgrrgypgymytdlatiyeragvvegkkgsvtqipilsmpd ddrthpipdltgyitegqiqlsrelhrkgiyppidplpslsrl
Timeline for d3gqbb2: