![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
![]() | Superfamily d.45.1: ClpS-like [54736] (3 families) ![]() |
![]() | Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins) |
![]() | Protein automated matches [190034] (3 species) not a true protein |
![]() | Species Caulobacter vibrioides [TaxId:155892] [188665] (5 PDB entries) |
![]() | Domain d3gq1a_: 3gq1 A: [176901] automated match to d1mbuc_ complexed with mg |
PDB Entry: 3gq1 (more details), 1.5 Å
SCOPe Domain Sequences for d3gq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gq1a_ d.45.1.2 (A:) automated matches {Caulobacter vibrioides [TaxId: 155892]} tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva etkvaqvidsarrhqhplqctmekd
Timeline for d3gq1a_: