Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 proteins) contains extra N-terminal 3-helical domain this is a repeat family; one repeat unit is 6amy A:120-137 found in domain |
Protein automated matches [191042] (3 species) not a true protein |
Species Yersinia pestis [TaxId:632] [188875] (1 PDB entry) |
Domain d3gosa_: 3gos A: [176791] automated match to d1kgqa_ complexed with mg |
PDB Entry: 3gos (more details), 1.8 Å
SCOPe Domain Sequences for d3gosa_:
Sequence, based on SEQRES records: (download)
>d3gosa_ b.81.1.2 (A:) automated matches {Yersinia pestis [TaxId: 632]} qsmqqlqnvietaferraditpanvdtvtreaithvidlldtgalrvaekidgqwvthqw lkkavllsfrindnqvmegaetryydkvpmkfagydearfqregfrvvppatvrkgafia rntvlmpsyvnigafvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanptii edncfvgarsevvegviveegsvismgvfigqstriydretgevhygrvpagsvvvsgnl pskdgsyslycavivkkvdaktrskvginellrtid
>d3gosa_ b.81.1.2 (A:) automated matches {Yersinia pestis [TaxId: 632]} qsmqqlqnvietaferraditpanvdtvtreaithvidlldtgalrvaekidgqwvthqw lkkavllsfrindnqvmegaetryydkvpmkfagydearfqregfrvvppatvrkgafia rntvlmpsyvnigafvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqanptii edncfvgarsevvegviveegsvismgvfigqstriydretgevhygrvpagsvvvsgnl pskdgsyslycavivkkvdaginellrtid
Timeline for d3gosa_: