Lineage for d3gg3a_ (3gg3 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.1: Bromodomain [47371] (5 proteins) 
Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries) 
Domain d3gg3a_: 3gg3 A: [176610]
automated match to d1jm4b_
complexed with cl
Details for d3gg3a_
PDB Entry: 3gg3 (more details), 2.25 Å
PDB Description: crystal structure of the bromodomain of human pcaf
PDB Compounds: (A:) Histone acetyltransferase PCAFSCOPe Domain Sequences for d3gg3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gg3a_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs
kklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
SCOPe Domain Coordinates for d3gg3a_:
Click to download the PDB-style file with coordinates for d3gg3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gg3a_:
- d3gg3a_ first appeared in SCOPe 2.01
- d3gg3a_ appears in SCOPe 2.04
- d3gg3a_ appears in SCOPe 2.06
- d3gg3a_ appears in the current release, SCOPe 2.08
View in 3D
