Lineage for d3gfva_ (3gfv A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.92: Chelatase-like [53799] (3 superfamilies)
duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) 
contains a long alpha helical insertion in the interdomain linker
Family c.92.2.0: automated matches [191548] (1 protein)
not a true familyProtein automated matches [190944] (28 species)
not a true protein
Species Bacillus subtilis [TaxId:224308] [232282] (2 PDB entries) 
Domain d3gfva_: 3gfv A: [232283]
automated match to d3tefa_
complexed with asn, po4
Details for d3gfva_
PDB Entry: 3gfv (more details), 1.75 Å
PDB Description: crystal structure of petrobactin-binding protein yclq from bacillu subtilis
PDB Compounds: (A:) Uncharacterized ABC transporter solute-binding protein yclQSCOPe Domain Sequences for d3gfva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gfva_ c.92.2.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
keqitvkhqldkngtkvpknpkkvvvfdfgsldtldklglddivaglpkqvlpkylskfk
ddkyadvgslkepdfdkvaeldpdliiisarqsesykefskiaptiylgvdtakymesfk
sdaetigkifdkedkvkdelanidhsiadvkktaeklnknglvimandgkisafgpksry
glihdvfgvapadqnikasthgqsvsyeyisktnpdylfvidrgtaigetsstkqvvend
yvknvnavknghviyldsatwylsggglesmtqmikevkdgleken
SCOPe Domain Coordinates for d3gfva_:
Click to download the PDB-style file with coordinates for d3gfva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gfva_:
- d3gfva_ first appeared in SCOPe 2.03
- d3gfva_ appears in SCOPe 2.04
- d3gfva_ is called d3gfva1 in SCOPe 2.06
- d3gfva_ appears in the current release, SCOPe 2.08, called d3gfva1
View in 3D
