Lineage for d3gfta_ (3gft A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476240Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)
  8. 2476677Domain d3gfta_: 3gft A: [176604]
    Other proteins in same PDB: d3gftb2, d3gftc2, d3gfte2, d3gftf2
    automated match to d1aa9a_
    complexed with cit, gnp, mg, unx

Details for d3gfta_

PDB Entry: 3gft (more details), 2.27 Å

PDB Description: human k-ras (q61h) in complex with a gtp analogue
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d3gfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gfta_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d3gfta_:

Click to download the PDB-style file with coordinates for d3gfta_.
(The format of our PDB-style files is described here.)

Timeline for d3gfta_: