Lineage for d3ge6a_ (3ge6 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) 
Family d.90.1.0: automated matches [191446] (1 protein)
not a true familyProtein automated matches [190672] (32 species)
not a true protein
Species Exiguobacterium sibiricum [TaxId:262543] [188806] (1 PDB entry) 
Domain d3ge6a_: 3ge6 A: [176567]
automated match to d2b67a1
complexed with fmn
Details for d3ge6a_
PDB Entry: 3ge6 (more details), 1.85 Å
PDB Description: crystal structure of a putative nitroreductase in complex with fmn (exig_2970) from exiguobacterium sibiricum 255-15 at 1.85 a resolution
PDB Compounds: (A:) NitroreductaseSCOPe Domain Sequences for d3ge6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ge6a_ d.90.1.0 (A:) automated matches {Exiguobacterium sibiricum [TaxId: 262543]}
ttqtatdfmeivkgrrsirnydtnvkiskeemtqileeatlapssvnmqpwrflvidsee
gkatlaplakfnqvqvetssaviavfgdmkaidqleniydtavekglmpqevrdrqvpai
qgmyenvpasalkdsilidsglvsmqlmlvarahgydtnpiggyekdqiaeafgmekdry
vpvmllsigkavdagypsvrlpindiadwk
SCOPe Domain Coordinates for d3ge6a_:
Click to download the PDB-style file with coordinates for d3ge6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ge6a_:
- d3ge6a_ first appeared in SCOPe 2.01
- d3ge6a_ appears in SCOPe 2.07
View in 3D
