Lineage for d3gb8b2 (3gb8 B:1-66)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038910Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3038916Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) (S)
  5. 3038917Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein)
    Pfam PF11538; PubMed 18187419
  6. 3038918Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species)
  7. 3038919Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries)
  8. 3038921Domain d3gb8b2: 3gb8 B:1-66 [246278]
    Other proteins in same PDB: d3gb8a_, d3gb8b1, d3gb8b3
    protein/RNA complex
    has additional insertions and/or extensions that are not grouped together

Details for d3gb8b2

PDB Entry: 3gb8 (more details), 2.9 Å

PDB Description: crystal structure of crm1/snurportin-1 complex
PDB Compounds: (B:) Snurportin-1

SCOPe Domain Sequences for d3gb8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gb8b2 g.88.2.1 (B:1-66) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
meelsqalassfsvsqdlnstaaphprlsqykskyssleqserrrrllelqkskrldyvn
harrla

SCOPe Domain Coordinates for d3gb8b2:

Click to download the PDB-style file with coordinates for d3gb8b2.
(The format of our PDB-style files is described here.)

Timeline for d3gb8b2:

3038921
d3gb8b2 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3gb8a_