Lineage for d3g6dh1 (3g6d H:1-122)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2352857Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (35 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2352906Domain d3g6dh1: 3g6d H:1-122 [344722]
    Other proteins in same PDB: d3g6da_, d3g6dh2, d3g6dl1, d3g6dl2
    complexed with so4

Details for d3g6dh1

PDB Entry: 3g6d (more details), 3.2 Å

PDB Description: Crystal structure of the complex between CNTO607 Fab and IL-13
PDB Compounds: (H:) CNTO607 Fab Heavy chain

SCOPe Domain Sequences for d3g6dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6dh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qvqlvesggglvqpggslrlscaasgftfnsywinwvrqapgkglewvsgiaydssntly
adsvkgrftisrdnskntlylqmnslraedtavyycarglgafhwdmqpdywgqgtlvtv
ss

SCOPe Domain Coordinates for d3g6dh1:

Click to download the PDB-style file with coordinates for d3g6dh1.
(The format of our PDB-style files is described here.)

Timeline for d3g6dh1: