Lineage for d3g46a_ (3g46 A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Hemoglobin I [46464] (2 species) Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries) 
Domain d3g46a_: 3g46 A: [176334]
automated match to d1nxfa_
complexed with cmo, hem, xe
Details for d3g46a_
PDB Entry: 3g46 (more details), 0.91 Å
PDB Description: ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and chloroform bound to the xe4 cavity
PDB Compounds: (A:) Globin-1SCOPe Domain Sequences for d3g46a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g46a_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
mandklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
vlasknfgdkyanawaklvavvqaal
SCOPe Domain Coordinates for d3g46a_:
Click to download the PDB-style file with coordinates for d3g46a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3g46a_:
- d3g46a_ first appeared in SCOPe 2.01
- d3g46a_ appears in SCOPe 2.07
View in 3D
