Lineage for d3g3cb1 (3g3c B:2-257)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.151: DNase I-like [56218] (1 superfamily)
contains beta-sandwich; duplication of alpha+beta motifSuperfamily d.151.1: DNase I-like [56219] (4 families) 
Family d.151.1.0: automated matches [191468] (1 protein)
not a true familyProtein automated matches [190734] (14 species)
not a true proteinSpecies Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries) 
Domain d3g3cb1: 3g3c B:2-257 [246234]
Other proteins in same PDB: d3g3cb2
automated match to d3g4tb_
protein/DNA complex; complexed with mg, mrd, po4
Details for d3g3cb1
PDB Entry: 3g3c (more details), 3.04 Å
PDB Description: mth0212 (wt) in complex with a 6bp dsdna containing a single one nucleotide long 3'-overhang
PDB Compounds: (B:) exodeoxyribonucleaseSCOPe Domain Sequences for d3g3cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g3cb1 d.151.1.0 (B:2-257) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleiel
SCOPe Domain Coordinates for d3g3cb1:
Click to download the PDB-style file with coordinates for d3g3cb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3g3cb1:
- d3g3cb1 first appeared in SCOPe 2.04, called d3g3cb_
- d3g3cb1 appears in SCOPe 2.07
View in 3D
