Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (16 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [232223] (12 PDB entries) |
Domain d3g1ma1: 3g1m A:22-94 [232225] Other proteins in same PDB: d3g1ma2 automated match to d1t56a1 protein/DNA complex; complexed with rf3 |
PDB Entry: 3g1m (more details), 1.7 Å
SCOPe Domain Sequences for d3g1ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g1ma1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn qadmalqtlaenp
Timeline for d3g1ma1: