Lineage for d3g1ha_ (3g1h A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435437Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2435583Protein automated matches [190130] (11 species)
    not a true protein
  7. 2435674Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries)
  8. 2435800Domain d3g1ha_: 3g1h A: [176265]
    automated match to d1dv7a_
    complexed with h2u

Details for d3g1ha_

PDB Entry: 3g1h (more details), 2.3 Å

PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6- dihydrouridine 5'-monophosphate
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3g1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g1ha_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvga
qggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdl

SCOPe Domain Coordinates for d3g1ha_:

Click to download the PDB-style file with coordinates for d3g1ha_.
(The format of our PDB-style files is described here.)

Timeline for d3g1ha_: