| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (33 species) not a true protein |
| Species Brucella melitensis [TaxId:359391] [225607] (1 PDB entry) |
| Domain d3fvba_: 3fvb A: [210216] automated match to d1jgca_ complexed with cl, fe, hem, imd, mg, na |
PDB Entry: 3fvb (more details), 1.81 Å
SCOPe Domain Sequences for d3fvba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fvba_ a.25.1.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]}
gsmkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadkl
idriiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskq
lfdelladeeghidfletqldllakiggerygqlnaapade
Timeline for d3fvba_: