Lineage for d3fvba_ (3fvb A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729722Species Brucella melitensis [TaxId:359391] [225607] (1 PDB entry)
  8. 1729723Domain d3fvba_: 3fvb A: [210216]
    automated match to d1jgca_
    complexed with cl, fe, hem, imd, mg, na

Details for d3fvba_

PDB Entry: 3fvb (more details), 1.81 Å

PDB Description: crystal structure of ferritin (bacterioferritin) from brucella melitensis
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d3fvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fvba_ a.25.1.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]}
gsmkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadkl
idriiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskq
lfdelladeeghidfletqldllakiggerygqlnaapade

SCOPe Domain Coordinates for d3fvba_:

Click to download the PDB-style file with coordinates for d3fvba_.
(The format of our PDB-style files is described here.)

Timeline for d3fvba_: