Lineage for d3fv3a_ (3fv3 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2070410Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2070411Protein automated matches [190954] (11 species)
    not a true protein
  7. 2070421Species Candida parapsilosis [TaxId:5480] [188902] (2 PDB entries)
  8. 2070422Domain d3fv3a_: 3fv3 A: [176067]
    automated match to d1j71a_
    complexed with gol, so4

Details for d3fv3a_

PDB Entry: 3fv3 (more details), 1.85 Å

PDB Description: Secreted aspartic protease 1 from Candida parapsilosis in complex with pepstatin A
PDB Compounds: (A:) Sapp1p-secreted aspartic protease 1

SCOPe Domain Sequences for d3fv3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fv3a_ b.50.1.0 (A:) automated matches {Candida parapsilosis [TaxId: 5480]}
dsislslinegpsyaskvsvgsnkqqqtviidtgssdfwvvdsnaqcgkgvdckssgtft
psssssyknlgaaftirygdgstsqgtwgkdtvtingvsitgqqiadvtqtsvdqgilgi
gytsneavydtsgrqttpnydnvpvtlkkqgkirtnayslylnspsaetgtiifggvdna
kysgklvaeqvtssqaltislasvnlkgssfsfgdgalldsgttltyfpsdfaaqladka
garlvqvardqylyfidcntdtsgttvfnfgngakitvpnteyvyqngdgtclwgiqpsd
dtilgdnflrhayllynldantisiaqvkyttdssisav

SCOPe Domain Coordinates for d3fv3a_:

Click to download the PDB-style file with coordinates for d3fv3a_.
(The format of our PDB-style files is described here.)

Timeline for d3fv3a_: