SCOPe 2.08: Domain d3frua1: 3fru A:179-269

Lineage for d3frua1 (3fru A:179-269)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88613] (3 PDB entries)
Domain d3frua1: 3fru A:179-269 [20657]
Other proteins in same PDB: d3frua2, d3frub_, d3fruc2, d3frud_, d3frue2, d3fruf_
complexed with bme, nag, so4

Details for d3frua1

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

PDB Compounds: (A:) neonatal fc receptor

SCOPe Domain Sequences for d3frua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
keppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfha
wsllevkrgdehhyqcqveheglaqpltvdl

SCOPe Domain Coordinates for d3frua1:

Click to download the PDB-style file with coordinates for d3frua1.
(The format of our PDB-style files is described here.)

Timeline for d3frua1: