Lineage for d3fhsa1 (3fhs A:4-83)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370778Species Soybean (Glycine max) [TaxId:3847] [225579] (2 PDB entries)
  8. 1370781Domain d3fhsa1: 3fhs A:4-83 [209928]
    Other proteins in same PDB: d3fhsa2, d3fhsb2
    automated match to d1gwca2
    complexed with gsh

Details for d3fhsa1

PDB Entry: 3fhs (more details), 2.71 Å

PDB Description: Glutathione transferase from Glycine max at 2.7 resolution
PDB Compounds: (A:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d3fhsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhsa1 c.47.1.0 (A:4-83) automated matches {Soybean (Glycine max) [TaxId: 3847]}
evvlldfwpspfgmrvrialaekgikyeykeedlrnksplllqmnpvhkkipvlihngkp
icesliavqyieevwndrnp

SCOPe Domain Coordinates for d3fhsa1:

Click to download the PDB-style file with coordinates for d3fhsa1.
(The format of our PDB-style files is described here.)

Timeline for d3fhsa1:

1370781
d3fhsa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3fhsa2