Lineage for d3fgza_ (3fgz A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein automated matches [190177] (9 species)
not a true proteinSpecies Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries) 
Domain d3fgza_: 3fgz A: [175778]
automated match to d1miha_
complexed with bef, gol, mn, nh4; mutant
Details for d3fgza_
PDB Entry: 3fgz (more details), 2 Å
PDB Description: crystal structure of chey triple mutant f14e, n59m, e89r complexed with bef3- and mn2+
PDB Compounds: (A:) Chemotaxis protein cheYSCOPe Domain Sequences for d3fgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fgza_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
SCOPe Domain Coordinates for d3fgza_:
Click to download the PDB-style file with coordinates for d3fgza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fgza_:
- d3fgza_ first appeared in SCOPe 2.01
- d3fgza_ appears in SCOPe 2.07
View in 3D
