![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein automated matches [190177] (9 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries) |
![]() | Domain d3fgza_: 3fgz A: [175778] automated match to d1miha_ complexed with bef, gol, mn, nh4; mutant |
PDB Entry: 3fgz (more details), 2 Å
SCOPe Domain Sequences for d3fgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fgza_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d3fgza_: