Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.5: F17c-type adhesin [89215] (3 proteins) automatically mapped to Pfam PF09222 |
Protein automated matches [190525] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [187483] (6 PDB entries) |
Domain d3ffoa_: 3ffo A: [175757] automated match to d1oioa_ complexed with ni, so4, trs |
PDB Entry: 3ffo (more details), 2.1 Å
SCOPe Domain Sequences for d3ffoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ffoa_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]} vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
Timeline for d3ffoa_: