Lineage for d3ffoa_ (3ffo A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040818Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
    automatically mapped to Pfam PF09222
  6. 2040833Protein automated matches [190525] (1 species)
    not a true protein
  7. 2040834Species Escherichia coli [TaxId:562] [187483] (6 PDB entries)
  8. 2040838Domain d3ffoa_: 3ffo A: [175757]
    automated match to d1oioa_
    complexed with ni, so4, trs

Details for d3ffoa_

PDB Entry: 3ffo (more details), 2.1 Å

PDB Description: f17b-g lectin domain with bound glcnac(beta1-2)man
PDB Compounds: (A:) adhesin

SCOPe Domain Sequences for d3ffoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffoa_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt

SCOPe Domain Coordinates for d3ffoa_:

Click to download the PDB-style file with coordinates for d3ffoa_.
(The format of our PDB-style files is described here.)

Timeline for d3ffoa_: