Lineage for d3fdua_ (3fdu A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354733Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1354734Protein automated matches [190246] (42 species)
    not a true protein
  7. 1354735Species Acinetobacter baumannii [TaxId:400667] [225573] (1 PDB entry)
  8. 1354736Domain d3fdua_: 3fdu A: [209864]
    automated match to d3peaf_
    complexed with gol, so4

Details for d3fdua_

PDB Entry: 3fdu (more details), 2 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii
PDB Compounds: (A:) Putative enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3fdua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fdua_ c.14.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
slhphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehd
ftagndmkdfmgfvqnpnagpagqvppfvllksaarlskpliiavkgvaigigvtillqa
dlvfadntalfqipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglv
neivedayataqataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspem
leavqafm

SCOPe Domain Coordinates for d3fdua_:

Click to download the PDB-style file with coordinates for d3fdua_.
(The format of our PDB-style files is described here.)

Timeline for d3fdua_: