Lineage for d3fd7a_ (3fd7 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (2 families) 
can be classified as disulfide-richFamily d.5.1.1: Ribonuclease A-like [54077] (9 proteins) 
Protein automated matches [190061] (6 species)
not a true protein
Species Frog (Rana pipiens) [TaxId:8404] [188156] (4 PDB entries) 
Domain d3fd7a_: 3fd7 A: [175705]
automated match to d1onca_
complexed with edo, gol, so4
Details for d3fd7a_
PDB Entry: 3fd7 (more details), 1.53 Å
PDB Description: crystal structure of onconase c87a/c104a-onc
PDB Compounds: (A:) Protein P-30SCOPe Domain Sequences for d3fd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fd7a_ d.5.1.1 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfavtcenqapvhfvgvgs
SCOPe Domain Coordinates for d3fd7a_:
Click to download the PDB-style file with coordinates for d3fd7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fd7a_:
- d3fd7a_ first appeared in SCOPe 2.01
- d3fd7a_ appears in SCOPe 2.04
- d3fd7a_ appears in SCOPe 2.06
- d3fd7a_ appears in the current release, SCOPe 2.08
View in 3D
