Lineage for d3f9ra_ (3f9r A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.0: automated matches [191369] (1 protein)
not a true familyProtein automated matches [190447] (49 species)
not a true protein
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188800] (1 PDB entry) 
Domain d3f9ra_: 3f9r A: [175602]
automated match to d2amya1
complexed with mg, so4
Details for d3f9ra_
PDB Entry: 3f9r (more details), 1.85 Å
PDB Description: crystal structure of trypanosoma brucei phosphomannosemutase, tb.10.700.370
PDB Compounds: (A:) PhosphomannomutaseSCOPe Domain Sequences for d3f9ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f9ra_ c.108.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gmkrvlllfdvdgtltpprlcqtdemralikrargagfcvgtvggsdfakqveqlgrdvl
tqfdyvfaengllayrngleihrqsllnalgndrivkfvkktlrliadldipvqrgtfve
yrngminvspigrncsqaerdefevydnehrvrasliaelensfpdfglkysiggqisfd
vfpvgwdktyclqfveddfeeihffgdktqeggndyeiytdkrtighkvtsykdtiaeve
kiiamk
SCOPe Domain Coordinates for d3f9ra_:
Click to download the PDB-style file with coordinates for d3f9ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3f9ra_:
- d3f9ra_ first appeared in SCOPe 2.01
- d3f9ra_ appears in SCOPe 2.04
- d3f9ra_ is called d3f9ra1 in SCOPe 2.06
- d3f9ra_ appears in the current release, SCOPe 2.08, called d3f9ra1
View in 3D
