Lineage for d3f66a_ (3f66 A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
PTK group; HGFR subfamily; membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries) 
Domain d3f66a_: 3f66 A: [199391]
automated match to d3f66b_
complexed with gbl, ihx, na
Details for d3f66a_
PDB Entry: 3f66 (more details), 1.4 Å
PDB Description: Human c-Met Kinase in complex with quinoxaline inhibitor
PDB Compounds: (A:) Hepatocyte growth factor receptorSCOPe Domain Sequences for d3f66a_:
Sequence, based on SEQRES records: (download)
>d3f66a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
ethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmyd
keyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehy
Sequence, based on observed residues (ATOM records): (download)
>d3f66a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkihcavkslnrit
digevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnp
tvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyys
vaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrr
llqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehy
SCOPe Domain Coordinates for d3f66a_:
Click to download the PDB-style file with coordinates for d3f66a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3f66a_:
- d3f66a_ first appeared in SCOPe 2.03
- d3f66a_ appears in SCOPe 2.05
- d3f66a_ appears in SCOPe 2.07
- d3f66a_ appears in the current release, SCOPe 2.08
View in 3D
