Lineage for d3f52a_ (3f52 A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
core: 4 helices; folded leaf, closedSuperfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) 
Family a.35.1.0: automated matches [191534] (1 protein)
not a true familyProtein automated matches [190907] (17 species)
not a true protein
Species Corynebacterium glutamicum [TaxId:1718] [346176] (2 PDB entries) 
Domain d3f52a_: 3f52 A: [344712]
automated match to d5woqa_
complexed with gol
Details for d3f52a_
PDB Entry: 3f52 (more details), 1.75 Å
PDB Description: Crystal structure of the clp gene regulator ClgR from C. glutamicum
PDB Compounds: (A:) clp gene regulator (ClgR)SCOPe Domain Sequences for d3f52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f52a_ a.35.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
epllrealgaalrsfradkgvtlrelaeasrvspgylselergrkevssellasvchalg
asvadvlieaagsmalq
SCOPe Domain Coordinates for d3f52a_:
Click to download the PDB-style file with coordinates for d3f52a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3f52a_:
- d3f52a_ is new in SCOPe 2.07-stable
- d3f52a_ appears in the current release, SCOPe 2.08
View in 3D
