![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (61 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [189083] (3 PDB entries) |
![]() | Domain d3f3ma_: 3f3m A: [175444] automated match to d1o6ba_ complexed with pps |
PDB Entry: 3f3m (more details), 2.4 Å
SCOPe Domain Sequences for d3f3ma_:
Sequence, based on SEQRES records: (download)
>d3f3ma_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm sstnysfisssivkevaayradisefvppyvekalkkkfk
>d3f3ma_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} mehtiavipgsfdpityghldiierstdrfdeihvcvlkgtfsleermdlieqsvkhlpn vkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymmsstny sfisssivkevaayradisefvppyvekalkkkfk
Timeline for d3f3ma_: