Lineage for d3f3ha_ (3f3h A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.21: Fungal immunomodulatory protein, FIP [101542] (1 family) 
automatically mapped to Pfam PF09259Family b.1.21.1: Fungal immunomodulatory protein, FIP [101543] (2 proteins) 
Protein automated matches [191068] (2 species)
not a true protein
Species Ganoderma lucidum [TaxId:5315] [188973] (1 PDB entry) 
Domain d3f3ha_: 3f3h A: [175442]
automated match to d1osya_
Details for d3f3ha_
PDB Entry: 3f3h (more details), 2.1 Å
PDB Description: Crystal structure and anti-tumor activity of LZ-8 from the fungus Ganoderma lucidium
PDB Compounds: (A:) Immunomodulatory protein Ling Zhi-8SCOPe Domain Sequences for d3f3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f3ha_ b.1.21.1 (A:) automated matches {Ganoderma lucidum [TaxId: 5315]}
sdtalifrlawdvkklsfdytpnwgrgnpnnfidtvtfpkvltdkaytyrvavsgrnlgv
kpsyavesdgsqkvnfleynsgygiadtntiqvfvvdpdtnndfiiaqwn
SCOPe Domain Coordinates for d3f3ha_:
Click to download the PDB-style file with coordinates for d3f3ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3f3ha_:
- d3f3ha_ first appeared in SCOPe 2.01
- d3f3ha_ appears in SCOPe 2.05
- d3f3ha_ appears in SCOPe 2.07
- d3f3ha_ appears in the current release, SCOPe 2.08
View in 3D
